Germany
Japan
United Kingdom
China
Goat Anti-ACADVL (VLCAD) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DKSDSHPSDALTRK-C, from the N-Terminus (near) of the protein sequence according to NP_000009.1; NP_001029031.1. |
Antibodies
View as table Download
Rabbit polyclonal anti-ACADVL antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 441 of rat ACADVL |
Rabbit Polyclonal Anti-ACADVL Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACADVL antibody: synthetic peptide directed towards the N terminal of human ACADVL. Synthetic peptide located within the following region: RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV |
Rabbit Polyclonal Anti-ACADVL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACADVL antibody: synthetic peptide directed towards the C terminal of human ACADVL. Synthetic peptide located within the following region: IDLYAMVVVLSRASRSLSEGHPTAQHEKMLCDTWCIEAAARIREGMAALQ |
Rabbit Polyclonal Anti-ACADVL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACADVL |
ACADVL rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACADVL |
ACADVL Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ACADVL (NP_000009.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ACADVL