Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Anti-ACAT1 (aa257-269) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACAT1 (aa257-269) Antibody: Peptide with sequence C-KRVDFSKVPKLKT, from the internal region of the protein sequence according to NP_000010.1. |
ACAT1 mouse monoclonal antibody, clone AT15E5, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
ACAT1 (N-term) mouse monoclonal antibody, clone AT1.H11, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
ACAT1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide |
ACAT1 mouse monoclonal antibody, clone AT15E5, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
ACAT1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Rat |
| Immunogen | Synthetic peptide |
Rabbit Polyclonal Anti-ACAT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH |
Rabbit Polyclonal Anti-ACAT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL |
Mouse anti-ACAT1 monoclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti-ACAT1 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Porcine, Rat, Murine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ACAT1. |
Goat Anti-ACAT1 (aa253-266) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DEEYKRVDFSKVPK, from the internal region of the protein sequence according to NP_000010.1. |
ACAT1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACAT1 antibody is: synthetic peptide directed towards the middle region of Human THIL |
ACAT1 Antibody - middlel region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse ACAT1 |
ACAT1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human ACAT1 (NP_000010.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ACAT1
Filter by
Category
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
Families
Pathways
- Butanoate metabolism (13)
- Fatty acid metabolism (13)
- Lysine degradation (13)
- Metabolic pathways (13)
- Propanoate metabolism (13)
- Pyruvate metabolism (13)
- Synthesis and degradation of ketone bodies (13)
- Terpenoid backbone biosynthesis (13)
- Tryptophan metabolism (13)
- Valine (13)
- leucine and isoleucine degradation (13)