Germany
Japan
United Kingdom
China
ADI1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 87-116 amino acids from the Central region of human ADI1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ADI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADI1 antibody is: synthetic peptide directed towards the N-terminal region of Human ADI1. Synthetic peptide located within the following region: YMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKI |
Rabbit Polyclonal Anti-ADI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADI1 antibody is: synthetic peptide directed towards the middle region of Human ADI1. Synthetic peptide located within the following region: DKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEK |
ADI1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ADI1 |
ADI1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-179 of human ADI1 (NP_060739.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ADI1