AGAP2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human AGAP2 |
AGAP2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human AGAP2 |
Rabbit Polyclonal Anti-AGAP2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human AGAP2 |
Rabbit Polyclonal PIKE Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | PIKE antibody was raised against a peptide corresponding to 15 amino acids near the C-terminus of human PIKE. |
Centaurin gamma 1 (AGAP2) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 850-877 amino acids from the C-terminal region of human CENTG1 |
Goat Anti-CENTG1 / PIKE Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QASLDSIREAVINSQ, from the internal region of the protein sequence according to NP_055585.1. |
Rabbit polyclonal anti-AGAP2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This protein A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corresponding to amino acids 1-836 of human AGAP2 protein. |
Rabbit Polyclonal Anti-CENTG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CENTG1 antibody: synthetic peptide directed towards the middle region of human CENTG1. Synthetic peptide located within the following region: AHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQG |