Rabbit Polyclonal Anti-ANP32A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANP32A antibody: synthetic peptide directed towards the middle region of human ANP32A. Synthetic peptide located within the following region: FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE |
Rabbit Polyclonal Anti-ANP32A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANP32A antibody: synthetic peptide directed towards the N terminal of human ANP32A. Synthetic peptide located within the following region: MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTI |
Rabbit anti-ANP32A Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ANP32A |
USD 440.00
2 Weeks
PHAP1 (ANP32A) (C-term) The immunogen is located within the last 50 amino acids of PHAP rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | ANP32A antibody was raised against synthetic peptide corresponding to amino acids at carboxy terminus of human PHAP I |
Rabbit Polyclonal PHAP I Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | PHAP I antibody was raised with a synthetic peptide corresponding to amino acids close to carboxy terminus of human PHAP I. This sequence is identical between human and rat PHAP I. |
ANP32A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ANP32A |
ANP32A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ANP32A |
ANP32A rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Germany
Japan
United Kingdom
China
