Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ANXA4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA4 antibody: synthetic peptide directed towards the N terminal of human ANXA4. Synthetic peptide located within the following region: GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ |
Rabbit Polyclonal Anti-ANXA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA4 antibody: synthetic peptide directed towards the middle region of human ANXA4. Synthetic peptide located within the following region: EGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSL |
Rabbit anti Annexin IV Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus of human Annexin IV. This sequence is identical to human, mouse and rat. |
Annexin A4/Annexin IV Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 112-321 of human Annexin A4/Annexin IV (NP_001144.1). |
| Modifications | Unmodified |
Annexin A4/Annexin IV Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 112-321 of human Annexin A4/Annexin IV (NP_001144.1). |
| Modifications | Unmodified |
USD 523.00
2 Weeks
Active filters
Target Symbol
- ANXA4