Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-ANXA5 Polyclonal Antibody
| Applications | ELISA, ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Annexin V (ANXA5) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human Annexin V |
Rabbit Polyclonal Anti-ANXA5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA5 antibody: synthetic peptide directed towards the N terminal of human ANXA5. Synthetic peptide located within the following region: SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE |
Rabbit Polyclonal Anti-ANXA5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA5 antibody: synthetic peptide directed towards the N terminal of human ANXA5. Synthetic peptide located within the following region: AYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVV |
Anti-ANXA5 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 49-263 amino acids of human annexin A5 |
Anti-ANXA5 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 34-319 amino acids of human Alkaline phosphatase |
ANXA5 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse ANXA5 |
Annexin A5/Annexin V Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Annexin V Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human Annexin V protein fragments expressed in E.coli. |
Annexin V Rabbit polyclonal Antibody
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Annexin V |
Annexin V Rabbit polyclonal Antibody (HRP)
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | HRP |
| Immunogen | Purified recombinant human Annexin V protein fragments expressed in E.coli. |
Active filters
Target Symbol
- ANXA5