Antibodies

View as table Download

Rabbit anti-ANXA5 Polyclonal Antibody

Applications ELISA, ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Annexin V (ANXA5) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence near the C-terminal of Human Annexin V

Annexin V (ANXA5) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human Annexin V

Rabbit Polyclonal Anti-ANXA5 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA5 antibody: synthetic peptide directed towards the N terminal of human ANXA5. Synthetic peptide located within the following region: SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE

Rabbit Polyclonal Anti-ANXA5 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA5 antibody: synthetic peptide directed towards the N terminal of human ANXA5. Synthetic peptide located within the following region: AYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVV

Anti-ANXA5 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 49-263 amino acids of human annexin A5

Anti-ANXA5 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 34-319 amino acids of human Alkaline phosphatase

ANXA5 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse ANXA5

Annexin A5/Annexin V Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified

Annexin V Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen Purified recombinant human Annexin V protein fragments expressed in E.coli.

Annexin V Rabbit polyclonal Antibody

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Annexin V

Annexin V Rabbit polyclonal Antibody (HRP)

Applications WB
Reactivities Human, Monkey
Conjugation HRP
Immunogen Purified recombinant human Annexin V protein fragments expressed in E.coli.