Germany
Japan
United Kingdom
China
gamma Adaptin (AP1G1) mouse monoclonal antibody, clone IMD-113, Purified
| Applications | WB |
| Reactivities | Human, Rat |
Antibodies
View as table DownloadGoat polyclonal anti-AP1G1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole goat serum produced by repeated immunizations with a synthetic peptide corresponding aa 646-659 of Human AP1G1. |
Rabbit Polyclonal Anti-AP1G1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AP1G1 antibody: synthetic peptide directed towards the C terminal of human AP1G1. Synthetic peptide located within the following region: DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS |
Rabbit Polyclonal Anti-Ap1g1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ap1g1 antibody is: synthetic peptide directed towards the middle region of Mouse Ap1g1. Synthetic peptide located within the following region: TPVIPTAPTSKPASAGGELLDLLGDITLTGAPAAAPTPASVPQISQPPFL |
Anti-AP1G1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 802-814 amino acids of Human Adapter-related protein complex 1 subunit gamma-1 |
AP1G1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human AP1G1 (NP_001025178). |
| Modifications | Unconjugated |
Active filters
Target Symbol
- AP1G1