Ap1g1 Rabbit Polyclonal Antibody

CAT#: TA339999

Rabbit Polyclonal Anti-Ap1g1 Antibody

Product Images

WB Suggested Anti-Ap1g1 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Ap1g1 antibody is: synthetic peptide directed towards the middle region of Mouse Ap1g1. Synthetic peptide located within the following region: TPVIPTAPTSKPASAGGELLDLLGDITLTGAPAAAPTPASVPQISQPPFL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 91 kDa
• Gene Name: adaptor protein complex AP-1, gamma 1 subunit
• Database Link:
  NP_033807
  Entrez Gene 11765 Mouse
  UniProt ID P22892
• Background: The function of this protein remains unknown.
• Synonyms: ADTG; CLAPG1; gamma1-adaptin; MGC18255
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%