Germany
Japan
United Kingdom
China
Rabbit polyclonal APPL1 antibody
| Applications | WB |
| Reactivities | Human Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human APPL1. |
Antibodies
View as table Download
Goat Polyclonal Antibody against APPL1
| Applications | WB |
| Reactivities | Expected from seq similarity: Human, Mouse, Rat, Dog, Cow |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NRYSRLSKKRENDK, from the internal region of the protein sequence according to NP_036228.1. |
Rabbit Polyclonal Anti-APPL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APPL1 antibody: synthetic peptide directed towards the middle region of human APPL1. Synthetic peptide located within the following region: GQAKAFGQGGRRTNPFGESGGSTKSETEDSILHQLFIVRFLGSMEVKSDD |
Carrier-free (BSA/glycerol-free) APPL1 mouse monoclonal antibody,clone OTI7C3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-APPL1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 |
Anti-APPL1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 |
APPL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human APPL1 |
APPL1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human APPL1 |
APPL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human APPL1 |
APPL1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human APPL1 |
APPL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human APPL1 (NP_036228.1). |
| Modifications | Unmodified |
APPL1 mouse monoclonal antibody,clone OTI7C3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
APPL1 mouse monoclonal antibody,clone OTI7C3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
APPL1 mouse monoclonal antibody,clone OTI7C3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
APPL1 mouse monoclonal antibody,clone OTI7C3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- APPL1