Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-ARHGEF1 antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ARHGEF1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ARHGEF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARHGEF1 antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGEF1. Synthetic peptide located within the following region: SAAVVNAIGLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKG |
Rabbit Polyclonal Anti-ARHGEF1 Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARHGEF1 |
ARHGEF1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ARHGEF1 |
ARHGEF1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARHGEF1 |
Active filters
Target Symbol
- ARHGEF1