Antibodies

View as table Download

Rabbit polyclonal anti-ARHGEF1 antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ARHGEF1.

Rabbit Polyclonal Anti-ARHGEF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARHGEF1 antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGEF1. Synthetic peptide located within the following region: SAAVVNAIGLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKG

Rabbit Polyclonal Anti-ARHGEF1 Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ARHGEF1

ARHGEF1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ARHGEF1

ARHGEF1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ARHGEF1

ARHGEF1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 783-912 of human ARHGEF1 (NP_004697.2).
Modifications Unmodified