Antibodies

Jump to Filters
View as table Download
Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody
TA346154

USD 410.00

2 Weeks

Rabbit Polyclonal Anti-ASL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASL antibody: synthetic peptide directed towards the middle region of human ASL. Synthetic peptide located within the following region: LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGREDK
Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody
TA308495

USD 415.00

5 Days

Rabbit polyclonal antibody to Argininosuccinate Lyase (argininosuccinate lyase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 13 and 261 of ASL (Uniprot ID#P04424)
Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody
TA346153

USD 475.00

5 Days

Rabbit Polyclonal Anti-ASL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASL antibody: synthetic peptide directed towards the N terminal of human ASL. Synthetic peptide located within the following region: GATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAE
Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody
TA308132

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to ASL (argininosuccinate lyase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 86 and 325 of ASL
Argininosuccinate Lyase (ASL) Mouse Monoclonal Antibody [Clone ID: OTI3D4]
CF802245

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ASL mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Argininosuccinate Lyase (ASL) Mouse Monoclonal Antibody [Clone ID: OTI9G2]
CF804902

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ASL mouse monoclonal antibody,clone OTI9G2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody
TA349501

USD 345.00

In Stock

Rabbit Polyclonal Anti-ASL Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ASL
Asl Rabbit Polyclonal Antibody
TA357819

USD 360.00

5 Days

Asl Antibody - C-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Asl Rabbit Polyclonal Antibody
TA362890

USD 360.00

5 Days

ASL Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse ASL
Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody
TA373742

USD 220.00

3 Weeks

ASL Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human ASL (NP_000039.2).
Modifications Unmodified
Argininosuccinate Lyase (ASL) Mouse Monoclonal Antibody [Clone ID: OTI9G2]
TA804902

USD 379.00

In Stock

ASL mouse monoclonal antibody,clone OTI9G2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Argininosuccinate Lyase (ASL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9G2]
TA804902AM

USD 420.00

4 Weeks

ASL mouse monoclonal antibody,clone OTI9G2, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Argininosuccinate Lyase (ASL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9G2]
TA804902BM

USD 420.00

4 Weeks

ASL mouse monoclonal antibody,clone OTI9G2, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Argininosuccinate Lyase (ASL) Mouse Monoclonal Antibody [Clone ID: OTI14C7]
TA804950

USD 379.00

In Stock

ASL mouse monoclonal antibody, clone OTI14C7 (formerly 14C7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".