Rabbit polyclonal ATG13 phospho S318 antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-ATG13 pS318 antibody was prepared by repeated immunizations with a synthetic peptide corresponding to the region near S318 of ATG13. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-ATG13 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared by repeated immunizations with a synthetic peptide corresponding to the S318 region of ATG13. |
Anti-ATG13 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human Autophagy-related protein 13 |
Rabbit Polyclonal Anti-ATG13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG13 antibody is: synthetic peptide directed towards the N-terminal region of Human ATG13. Synthetic peptide located within the following region: MCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLL |
Carrier-free (BSA/glycerol-free) ATG13 mouse monoclonal antibody,clone OTI1B1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ATG13 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ATG13 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ATG13 |
Phospho-ATG13-Ser355 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho synthetic peptide corresponding to residues surrounding Ser355 of human ATG13. |
| Modifications | Phospho Ser355 |
ATG13 phospho S318 Antibody
| Applications | ELISA, FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared by repeated immunizations with a synthetic peptide corresponding to the region near S318 of ATG13. |
ATG13 mouse monoclonal antibody,clone OTI1B1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ATG13 mouse monoclonal antibody,clone OTI1B1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ATG13 mouse monoclonal antibody,clone OTI1B1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ATG13 mouse monoclonal antibody,clone OTI1B1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
