Germany
Japan
United Kingdom
China
Antibodies
View as table Download
SPG3A (ATL1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 476-504 amino acids from the C-terminal region of human ATL1 |
Rabbit Polyclonal Anti-SPG3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPG3A antibody is: synthetic peptide directed towards the C-terminal region of Human SPG3A. Synthetic peptide located within the following region: DQVAAALWDQGSTNEALYKLYSAAATHRHLYHQAFPTPKSESTEQSEKKK |
ATL1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ATL1 |
ATL1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ATL1 |
Active filters
Target Symbol
- ATL1