Antibodies

View as table Download

Rabbit Polyclonal Anti-ATPIF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATPIF1 antibody: synthetic peptide directed towards the N terminal of human ATPIF1. Synthetic peptide located within the following region: GSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIER

Anti-ATPIF1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 26-106 amino acids of human ATPase inhibitory factor 1

Anti-ATPIF1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 26-106 amino acids of human ATPase inhibitory factor 1