Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Anti-ATXN3 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 120 aa to 250 aa of human ATXN3 produced in E. coli. |
Goat Polyclonal Anti-ATXN3 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 120 aa to 250 aa of human ATXN3 produced in E. coli. |
Goat Polyclonal Anti-ATXN3 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 120 aa to 250 aa of human ATXN3 produced in E. coli. |
Goat Polyclonal Anti-ATXN3 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 120 aa to 250 aa of human ATXN3 produced in E. coli. |
Rabbit Polyclonal Anti-ATXN3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATXN3 antibody: synthetic peptide directed towards the N terminal of human ATXN3. Synthetic peptide located within the following region: SIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNAL |
ATXN3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ATXN3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ATXN3 |
Ataxin 3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-364 of human Ataxin 3 (NP_004984.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ATXN3