Rabbit Polyclonal Anti-BCL7A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCL7A antibody: synthetic peptide directed towards the middle region of human BCL7A. Synthetic peptide located within the following region: CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN |
Rabbit Polyclonal Anti-BCL7A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCL7A antibody: synthetic peptide directed towards the middle region of human BCL7A. Synthetic peptide located within the following region: QENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQS |
Rabbit polyclonal anti-BCL7A antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BCL7A. |
Bcl 7A (BCL7A) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human BCL7A |
Goat Polyclonal Antibody against BCL7A
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-MKLEASQQNSEEM, from the C Terminus of the protein sequence according to NP_066273. |
Germany
Japan
United Kingdom
China
