Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-CABLES1 (Ik3-1) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Ik3-1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CABLES1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CABLES1 antibody is: synthetic peptide directed towards the C-terminal region of Human CABLES1. Synthetic peptide located within the following region: IRSLKREMRKLAQEDCGLEEPTVAMAFVYFEKLALKGKLNKQNRKLCAGA |
Carrier-free (BSA/glycerol-free) CABLES1 mouse monoclonal antibody,clone OTI2A3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CABLES1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CABLES1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CABLES1 |
CABLES1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-368 of human CABLES1 (NP_612384.1). |
| Modifications | Unmodified |
CABLES1 mouse monoclonal antibody,clone OTI2A3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CABLES1 mouse monoclonal antibody,clone OTI2A3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
CABLES1 mouse monoclonal antibody,clone OTI2A3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
CABLES1 mouse monoclonal antibody,clone OTI2A3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- CABLES1