CABLES1 Rabbit Polyclonal Antibody
Other products for "CABLES1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CABLES1 antibody is: synthetic peptide directed towards the C-terminal region of Human CABLES1. Synthetic peptide located within the following region: IRSLKREMRKLAQEDCGLEEPTVAMAFVYFEKLALKGKLNKQNRKLCAGA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 67 kDa |
Gene Name | Cdk5 and Abl enzyme substrate 1 |
Database Link | |
Background | This gene encodes a protein involved in regulation of the cell cycle through interactions with several cyclin-dependent kinases. One study reported aberrant splicing of transcripts from this gene which results in removal of the cyclin binding domain only in human cancer cells, and reduction in gene expression was shown in colorectal cancers.Multiple transcript variants encoding different isoforms have been found for this gene. |
Synonyms | CABL1; CABLES; HsT2563; IK3-1 |
Note | Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.