Antibodies

View as table Download

Rabbit Polyclonal CARD8 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CARD8 antibody was raised against a synthetic peptide corresponding to amino acids at the C-terminus of human CARD8.

CARD8 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CARD8

Anti-CARD8 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 200 amino acids of human Caspase recruitment domain-containing protein 8

Rabbit Polyclonal Anti-CARD8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CARD8 Antibody is: synthetic peptide directed towards the N-terminal region of Human CARD8. Synthetic peptide located within the following region: LGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELID

Rabbit Polyclonal Anti-CARD8 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CARD8

CARD8 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CARD8