Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CDCA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDCA4 antibody: synthetic peptide directed towards the N terminal of human CDCA4. Synthetic peptide located within the following region: MFARGLKRKCVGHEEDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHM |
Rabbit Polyclonal Anti-CDCA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDCA4 antibody: synthetic peptide directed towards the middle region of human CDCA4. Synthetic peptide located within the following region: SSAWEMDGPRENRGSFHKSLDQIFETLETKNPSCMEELFSDVDSPYYDLD |
CDCA4 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
CDCA4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-241 of human CDCA4 (NP_060425.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CDCA4