Rabbit Polyclonal Anti-CD8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the N terminal of human CD8B. Synthetic peptide located within the following region: RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI |
Rabbit Polyclonal Anti-CD8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the middle region of human CD8B. Synthetic peptide located within the following region: KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR |
Rabbit Polyclonal Anti-CD8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8B Antibody: A synthesized peptide derived from human CD8B |
CD8B mouse monoclonal antibody, clone EP42, Purified
| Applications | FC, IHC, IP |
| Reactivities | Chicken |
CD8B mouse monoclonal antibody, clone Du CD8-1, Purified
| Applications | FC, IP |
| Reactivities | Duck |
CD8B mouse monoclonal antibody, clone EP42, Biotin
| Applications | FC |
| Reactivities | Chicken |
| Conjugation | Biotin |
CD8B mouse monoclonal antibody, clone EP42, FITC
| Applications | FC |
| Reactivities | Chicken |
| Conjugation | FITC |
CD8B mouse monoclonal antibody, clone EP42, PE
| Applications | FC |
| Reactivities | Chicken |
| Conjugation | PE |
CD8B mouse monoclonal antibody, clone 11-39, FITC
| Applications | FC |
| Reactivities | Birds, Chicken |
| Conjugation | FITC |
CD8B mouse monoclonal antibody, clone 11-39, PE
| Applications | FC |
| Reactivities | Birds, Chicken |
| Conjugation | PE |
Cd8b mouse monoclonal antibody, clone 3.4.1, Biotin
| Applications | FC |
| Reactivities | Rat |
| Conjugation | Biotin |
Cd8b mouse monoclonal antibody, clone 3.4.1, Biotin
| Applications | FC |
| Reactivities | Rat |
| Conjugation | Biotin |
Cd8b mouse monoclonal antibody, clone 3.4.1, FITC
| Applications | FC |
| Reactivities | Rat |
| Conjugation | FITC |
Cd8b mouse monoclonal antibody, clone 3.4.1, PE
| Applications | FC |
| Reactivities | Rat |
| Conjugation | PE |
CD8B mouse monoclonal antibody, clone CC58, PE
| Applications | FC |
| Reactivities | Bovine |
| Conjugation | PE |
Rabbit Polyclonal anti-CD8B antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the middle region of human CD8B. Synthetic peptide located within the following region: LCCRRRRARLRFMKQPQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILK |
CD8B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-170 of human CD8B (NP_757362.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China