Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-CDC20 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CDC20. |
Rabbit Polyclonal Anti-CDC20 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC20 antibody: synthetic peptide directed towards the N terminal of human CDC20. Synthetic peptide located within the following region: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSH |
Mouse monoclonal Anti-Phospho-cdc20 (Ser50) Clone BM8.1
| Reactivities | Frog, Mammalian |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Phospho-cdc20 (Thr79) Clone BT2.1
| Reactivities | Frog |
Anti-CDC20 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 182-480 amino acids of Human Cell division cycle protein 20 homolog |
CDC20 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse CDC20 |
CDC20 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CDC20 |
CDC20 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human CDC20 (NP_001246.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CDC20