Antibodies

Jump to Filters
View as table Download
CDC42 Binding Protein Kinase Beta (CDC42BPB) Rabbit Polyclonal Antibody
TA314936

USD 345.00

In Stock

Rabbit polyclonal anti-MRCKB antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MRCKB.
CDC42 Binding Protein Kinase Beta (CDC42BPB) Rabbit Polyclonal Antibody
TA338137

USD 375.00

5 Days

Rabbit Polyclonal Anti-CDC42BPB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC42BPB antibody is: synthetic peptide directed towards the C-terminal region of Human CDC42BPB. Synthetic peptide located within the following region: GLKLPDFQDSIFEYFNTAPLAHDLTFRTSSASEQETQAPKPEASPSMSVA