Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CDKAP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDKAP1 Antibody: A synthesized peptide derived from human CDKAP1 |
Rabbit polyclonal anti-CDKA1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CDKA1. |
Rabbit Polyclonal Anti-CDK2AP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK2AP1 antibody is: synthetic peptide directed towards the C-terminal region of Human CDK2AP1. Synthetic peptide located within the following region: LLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS |
CDK2AP1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CDK2AP1 |
CDK2AP1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
CDK2AP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human CDK2AP1 (NP_004633.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CDK2AP1