Rabbit Polyclonal Anti-CDX1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CDX1 |
Rabbit Polyclonal Anti-CDX1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CDX1 |
Rabbit Polyclonal Cdx1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human Cdx1 protein (within residues 30-150). [Swiss-Prot P47902] |
Mouse monoclonal CDX1 Antibody (C-term)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CDX1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDX1 antibody: synthetic peptide directed towards the N terminal of human CDX1. Synthetic peptide located within the following region: GPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKDDWAAAYGPGP |
Rabbit Polyclonal Anti-Cdx1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cdx1 antibody: synthetic peptide directed towards the c terminal of mouse Cdx1. Synthetic peptide located within the following region: QQQPLPPTQLPLPLDGTPTPSGPPLGSLCPTNAGLLGTPSPVPVKEEFLP |
Mouse monoclonal Anti-CDX1 Clone 123a
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CDX1 mouse monoclonal antibody,clone OTI3A1
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CDX1 mouse monoclonal antibody,clone OTI2A5
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CDX1 mouse monoclonal antibody,clone OTI2E8
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CDX1 mouse monoclonal antibody,clone OTI1C7
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Cdx1 Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
CDX1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 136-265 of human CDX1 (NP_001795.2). |
Modifications | Unmodified |
CDX1 mouse monoclonal antibody,clone OTI3A1
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
CDX1 mouse monoclonal antibody,clone OTI3A1, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
CDX1 mouse monoclonal antibody,clone OTI3A1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
CDX1 mouse monoclonal antibody,clone OTI3A1
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
CDX1 mouse monoclonal antibody,clone OTI2A5
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
CDX1 mouse monoclonal antibody,clone OTI2A5, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
CDX1 mouse monoclonal antibody,clone OTI2A5, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
CDX1 mouse monoclonal antibody,clone OTI2A5
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
CDX1 mouse monoclonal antibody,clone OTI2E8
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
CDX1 mouse monoclonal antibody,clone OTI2E8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
CDX1 mouse monoclonal antibody,clone OTI2E8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
CDX1 mouse monoclonal antibody,clone OTI2E8
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
CDX1 mouse monoclonal antibody,clone OTI1C7
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
CDX1 mouse monoclonal antibody,clone OTI1C7, Biotinylated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
CDX1 mouse monoclonal antibody,clone OTI1C7, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
CDX1 mouse monoclonal antibody,clone OTI1C7
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |