Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-CENPA antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CENPA. |
Antibodies
View as table Download
Mouse monoclonal CENP-A Antibody
| Applications | WB |
| Reactivities | Human. Other species not yet tested |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CENPA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CENPA antibody: synthetic peptide directed towards the N terminal of human CENPA. Synthetic peptide located within the following region: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKE |
Rabbit Polyclonal Anti-CENPA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CENPA antibody: synthetic peptide directed towards the middle region of human CENPA. Synthetic peptide located within the following region: ALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG |
Rabbit polyclonal Centromeric Protein A (Ser7) antibody(Phospho-specific)
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Centromeric Protein A around the phosphorylation site of serine 7 (R-R-SP-R-K). |
| Modifications | Phospho-specific |
CENPA Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- CENPA