CENPA Rabbit Polyclonal Antibody

CAT#: TA338983

Rabbit Polyclonal Anti-CENPA Antibody

Product Images

WB Suggested Anti-CENPA Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate.CENPA is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Human Skin

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CENPA antibody: synthetic peptide directed towards the N terminal of human CENPA. Synthetic peptide located within the following region: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: centromere protein A
• Database Link:
  NP_001800
  Entrez Gene 1058 Human
  UniProt ID P49450
• Background: Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. CENPA encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]
• Synonyms: CenH3; CENP-A
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 90%; Mouse: 90%