Antibodies

View as table Download

Rabbit Polyclonal Anti-CHI3L1 Antibody

Applications IF, WB
Reactivities Human, SimianIVE
Conjugation Unconjugated
Immunogen The immunogen for anti-CHI3L1 antibody: synthetic peptide directed towards the middle region of human CHI3L1. Synthetic peptide located within the following region: LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL

CHI3L1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

YKL-40/CHI3L1 Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Modifications Unmodified

YKL-40/CHI3L1 Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified

YKL-40/CHI3L1 Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified