Germany
Japan
United Kingdom
China
CISD1 mouse monoclonal antibody, clone AT1A8, Purified
| Applications | ELISA, FC, WB |
| Reactivities | Human |
Antibodies
View as table Download
CISD1 mouse monoclonal antibody, clone AT1A8, Purified
| Applications | ELISA, FC, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-CISD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CISD1 antibody is: synthetic peptide directed towards the C-terminal region of Human CISD1. Synthetic peptide located within the following region: PKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLII |
CISD1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
CISD1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
CISD1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 29-108 of human CISD1 (NP_060934.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- CISD1