Antibodies

View as table Download

Rabbit Polyclonal Anti-CRIP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRIP2 Antibody: synthetic peptide directed towards the middle region of human CRIP2. Synthetic peptide located within the following region: TLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP

CRIP2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 178-208 amino acids from the C-terminal region of human CRIP2

Rabbit Polyclonal Anti-CRIP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRIP2 Antibody: synthetic peptide directed towards the N terminal of human CRIP2. Synthetic peptide located within the following region: EKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCP

CRIP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-208 of human CRIP2 (NP_001303.1).
Modifications Unmodified