Antibodies

Jump to Filters
View as table Download
Cornulin (CRNN) Rabbit Polyclonal Antibody
TA344123

USD 475.00

5 Days

Rabbit Polyclonal Anti-CRNN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRNN antibody: synthetic peptide directed towards the middle region of human CRNN. Synthetic peptide located within the following region: GDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG
Cornulin (CRNN) Mouse Monoclonal Antibody [Clone ID: OTI4B8]
CF811824

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CRNN mouse monoclonal antibody,clone OTI4B8

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Cornulin (CRNN) Rabbit Polyclonal Antibody
TA375105

USD 220.00

3 Weeks

CRNN Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 396-495 of human CRNN (NP_057274.1).
Modifications Unmodified