mu Crystallin (CRYM) mouse monoclonal antibody, clone 6B3
Applications | ELISA, IHC, WB |
Reactivities | Human |
mu Crystallin (CRYM) mouse monoclonal antibody, clone 6B3
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-CRYM Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CRYM antibody: synthetic peptide directed towards the N terminal of human CRYM. Synthetic peptide located within the following region: ALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRT |
Rabbit Polyclonal Anti-CRYM Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CRYM antibody: synthetic peptide directed towards the middle region of human CRYM. Synthetic peptide located within the following region: AHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFA |
Carrier-free (BSA/glycerol-free) CRYM mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CRYM mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CRYM rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CRYM |
CRYM rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CRYM |
CRYM Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-314 of human CRYM (NP_001879.1). |
Modifications | Unmodified |
Anti-CRYM (mu Crystallin) mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-CRYM (mu Crystallin) mouse monoclonal antibody, clone OTI1B5 (formerly 1B5), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-CRYM (mu Crystallin) mouse monoclonal antibody, clone OTI1B5 (formerly 1B5), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-CRYM (mu Crystallin) mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CRYM (mu Crystallin) mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CRYM (mu Crystallin) mouse monoclonal antibody, clone OTI1G7 (formerly 1G7), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
CRYM (mu Crystallin) mouse monoclonal antibody, clone OTI1G7 (formerly 1G7), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CRYM (mu Crystallin) mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |