Antibodies

Jump to Filters
View as table Download
Cleavage stimulation factor 2 (CSTF2) Rabbit Polyclonal Antibody
TA345769

USD 475.00

5 Days

Rabbit Polyclonal Anti-CSTF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSTF2 antibody: synthetic peptide directed towards the N terminal of human CSTF2. Synthetic peptide located within the following region: VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQA
Cleavage stimulation factor 2 (CSTF2) Rabbit Polyclonal Antibody
AP06681PU-N

USD 407.00

2 Weeks

Cleavage stimulation factor 2 (CSTF2) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids N-terminus of Human CstF-64.
Cleavage stimulation factor 2 (CSTF2) Rabbit Polyclonal Antibody
TA311679

USD 345.00

4 Weeks

Rabbit polyclonal anti-CSTF2 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human CSTF2.
Cstf2 Goat Polyclonal Antibody
TA326335

USD 375.00

5 Days

Goat Anti-betaCstF-64 variant 1/ betaCstF-64 variant 3 (mouse) Antibody

Applications IP, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-PASIERVQGQRT, from the internal region of the protein sequence according to ACF05702.1; ACF05700.1.
Cstf2 Rabbit Polyclonal Antibody
TA356088

USD 360.00

5 Days

Cstf2 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Cleavage stimulation factor 2 (CSTF2) Rabbit Polyclonal Antibody
TA375173

USD 220.00

3 Weeks

CSTF2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human CSTF2 (NP_001316.1).
Modifications Unmodified