Rabbit Polyclonal Anti-CTCFL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTCFL antibody: synthetic peptide directed towards the N terminal of human CTCFL. Synthetic peptide located within the following region: CREKDHRSPSELEAERTSGAFQDSVLEEEVELVLAPSEESEKYILTLQTV |
Rabbit polyclonal anti-BORIS antibody
| Applications | WB |
| Reactivities | Chimpanzee, Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding aa 9-26 of human BORIS protein. |
Rabbit Polyclonal Anti-CTCFL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTCFL antibody: synthetic peptide directed towards the N terminal of human CTCFL. Synthetic peptide located within the following region: RSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCD |
Mouse monoclonal Anti-BORIS Clone 4A7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CTCFL Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China