Rabbit Polyclonal Anti-CTRL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTRL antibody: synthetic peptide directed towards the N terminal of human CTRL. Synthetic peptide located within the following region: LLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL |
Rabbit Polyclonal Anti-CTRL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTRL antibody: synthetic peptide directed towards the N terminal of human CTRL. Synthetic peptide located within the following region: SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS |
CTRL Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 34-264 of human CTRL (NP_001898.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
