Antibodies

Jump to Filters
View as table Download
CXXC4 Rabbit Polyclonal Antibody
TA320030

USD 430.00

In Stock

Rabbit Polyclonal CXXC4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen CXXC4 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human CXXC4.
CXXC4 (C-term) Rabbit Polyclonal Antibody
AP51153PU-N

USD 450.00

2 Weeks

CXXC4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 164-194aa) of human CXXC4.
CXXC4 Rabbit Polyclonal Antibody
TA337976

USD 375.00

5 Days

Rabbit Polyclonal Anti-CXXC4 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-CXXC4 antibody is: synthetic peptide directed towards the C-terminal region of Human CXXC4. Synthetic peptide located within the following region: GGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCE