Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-DCX Antibody
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCX antibody: synthetic peptide directed towards the C terminal of human DCX. Synthetic peptide located within the following region: PEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRR |
Rabbit Polyclonal Anti-DCX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCX antibody: synthetic peptide directed towards the C terminal of human DCX. Synthetic peptide located within the following region: TAGPKASPTPQKTSAKSPGPMRRSKSPADSANGTSSSQLSTPKSKQSPIS |
Goat Anti-Doublecortin / DCX (aa232-242) Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KTSANMKAPQS, from the internal region of the protein sequence according to NP_000546.2; NP_835365.1; NP_835364.1; NP_001182482.1. |
Anti-DCX Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.413~417( P-T-S-P-G) derived from Human Doublecortin. |
DCX Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 11-360 of human DCX (NP_000546.2). |
| Modifications | Unmodified |
DCX Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 240-360 of human DCX (NP_835364.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- DCX