Antibodies

View as table Download

Rabbit Polyclonal Anti-DAZL Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-DAZL antibody is: synthetic peptide directed towards the C-terminal region of Human DAZL. Synthetic peptide located within the following region: PPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFR

Rabbit Polyclonal Anti-DAZL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DAZL antibody: synthetic peptide directed towards the C terminal of human DAZL. Synthetic peptide located within the following region: EVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLR

Goat Polyclonal Antibody against DAZL

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-GNGPQKKSVDR, from the internal region of the protein sequence according to NP_001342.2.

DAZL Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DAZL

DAZL Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 186-295 of human DAZL (NP_001342.2).
Modifications Unmodified

DAZL Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 186-295 of human DAZL (NP_001342.2).
Modifications Unmodified