Antibodies

View as table Download

Rabbit polyclonal antibody to Dhh (desert hedgehog homolog (Drosophila))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 135 and 396 of Dhh (Uniprot ID#O43323)

Rabbit Polyclonal Anti-DHH Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Dhh antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dhh. Synthetic peptide located within the following region: FRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRL

Rabbit Polyclonal Anti-DHH Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DHH

DHH Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 199-396 of human DHH (NP_066382.1).
Modifications Unmodified