Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal LGP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | LGP2 antibody was raised against a 11 amino acid peptide from near the center of human LGP2. |
Goat Anti-LGP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DFLQHCAENLSD, from the C Terminus of the protein sequence according to NP_077024.2. |
Rabbit Polyclonal LGP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | LGP2 antibody was raised against a 12 amino acid peptide from near the carboxy terminus of human LGP2. |
Rabbit Polyclonal LGP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | LGP2 antibody was raised against a 14 amino acid peptide from near the amino terminus of human LGP2. |
Rabbit Polyclonal Anti-DHX58 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHX58 antibody: synthetic peptide directed towards the N terminal of human DHX58. Synthetic peptide located within the following region: AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM |
DHX58 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DHX58 |
DHX58 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DHX58 |
DHX58 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 389-678 of human DHX58 (NP_077024.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- DHX58