Antibodies

Jump to Filters
View as table Download
DLL3 (C-term) Rabbit Polyclonal Antibody
AP51274PU-N

USD 450.00

2 Weeks

DLL3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 519-548 aa) of human DLL3.
DLL3 Rabbit Polyclonal Antibody
TA372428

USD 380.00

4 Weeks

DLL3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human DLL3
DLL3 Rabbit Polyclonal Antibody
TA337030

USD 424.00

5 Days

Rabbit Polyclonal DLL3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 100 to 150 of human DLL3 was used as immunogen for the antibody.
DLL3 Rabbit Polyclonal Antibody
TA342025

USD 375.00

5 Days

Rabbit Polyclonal Anti-DLL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DLL3 antibody is: synthetic peptide directed towards the C-terminal region of Human DLL3. Synthetic peptide located within the following region: LVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYLLPPALGLL
DLL3 Rabbit Polyclonal Antibody
TA342026

USD 375.00

5 Days

Rabbit Polyclonal Anti-DLL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLL3 antibody: synthetic peptide directed towards the N terminal of human DLL3. Synthetic peptide located within the following region: MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC
DLL3 Rabbit Polyclonal Antibody
TA368190

USD 380.00

4 Weeks

DLL3 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DLL3