Rabbit Polyclonal Anti-DLX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLX4 antibody: synthetic peptide directed towards the N terminal of human DLX4. Synthetic peptide located within the following region: YPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQ |
Rabbit polyclonal anti-DLX4 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DLX4. |
Rabbit Polyclonal Antibody against BP1
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made specifically to the human BP1 protein sequence (between residues 1-60).There is no homology with the peptide sequences used for immunogen of this antibody and the DLX4 or DLX7 proteins. |
Rabbit Polyclonal Anti-DLX4 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLX4 antibody: synthetic peptide directed towards the N terminal of mouse DLX4. Synthetic peptide located within the following region: YSHPGPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAESEKLALSLVP |
Rabbit Polyclonal anti-DLX4 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLX4 antibody: synthetic peptide directed towards the middle region of human DLX4. Synthetic peptide located within the following region: CQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPR |
Rabbit Polyclonal Anti-DLX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLX4 antibody: synthetic peptide directed towards the N terminal of human DLX4. Synthetic peptide located within the following region: KLSVLPPRSLLAPYTVLCCPPDSEKPRLSPEPSERRPQAPAKKLRKPRTI |
Rabbit Polyclonal Anti-DLX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLX4 antibody: synthetic peptide directed towards the middle region of human DLX4. Synthetic peptide located within the following region: RTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQM |
Rabbit Polyclonal Anti-DLX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DLX4 Antibody: synthetic peptide directed towards the middle region of human DLX4. Synthetic peptide located within the following region: ERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVS |
Rabbit Polyclonal Anti-DLX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DLX4 Antibody: synthetic peptide directed towards the N terminal of human DLX4. Synthetic peptide located within the following region: PQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQT |
Rabbit Polyclonal Anti-Dlx4 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Dlx4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AQLGLTQTQVKIWFQNKRSKYKKLLKQSSGEPEEDFSGRPPSLSPHSPAL |
Carrier-free (BSA/glycerol-free) DLX4 mouse monoclonal antibody, clone OTI7H10 (formerly 7H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-DLX4 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DLX4 |
Rabbit Polyclonal Anti-DLX4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DLX4 |
DLX4 Rabbit monoclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
DLX4 mouse monoclonal antibody, clone OTI7H10 (formerly 7H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DLX4 mouse monoclonal antibody, clone OTI7H10 (formerly 7H10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
DLX4 mouse monoclonal antibody, clone OTI7H10 (formerly 7H10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
DLX4 mouse monoclonal antibody, clone OTI7H10 (formerly 7H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
