Dlx4 Rabbit Polyclonal Antibody

CAT#: TA341753

Rabbit Polyclonal Anti-DLX4 Antibody

Product Images

WB Suggested Anti-DLX4 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: NIH/3T3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DLX4 antibody: synthetic peptide directed towards the N terminal of mouse DLX4. Synthetic peptide located within the following region: YSHPGPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAESEKLALSLVP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: distal-less homeobox 4
• Database Link:
  NP_031893
  Entrez Gene 13394 Mouse
  UniProt ID P70436
• Background: May play a role in determiningThe production of hemoglobin S. May act as a repressor.
• Synonyms: BP1; DLX-7; DLX-8; DLX7; DLX8; DLX9
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rat: 86%