Rabbit Polyclonal Anti-DMTF1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DMTF1 antibody: synthetic peptide directed towards the C terminal of human DMTF1. Synthetic peptide located within the following region: VIDTESVLPLTTLTDPILQHHQEESNIIGSSLGSPVSEDSKDVEDLVNCH |
Rabbit Polyclonal Anti-DMTF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DMTF1 antibody: synthetic peptide directed towards the N terminal of human DMTF1. Synthetic peptide located within the following region: CPQNEADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPCISVVALPLSEND |
Rabbit Polyclonal Anti-DMTF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DMTF1 antibody: synthetic peptide directed towards the C terminal of human DMTF1. Synthetic peptide located within the following region: SFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEESPSDLASAYVT |
Rabbit Polyclonal Anti-DMTF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DMTF1 antibody: synthetic peptide directed towards the N terminal of human DMTF1. Synthetic peptide located within the following region: LRMYDDRNHVGKYTPEEIEKLKELRIKHGNDWATIGAALGRSASSVKDRC |
Rabbit Polyclonal Anti-DMTF1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DMTF1 antibody: synthetic peptide directed towards the middle region of human DMTF1. Synthetic peptide located within the following region: TFPDEIHHPKMTVEPSFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDL |
DMTF1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 561-760 of human DMTF1 (NP_066968.3). |
Germany
Japan
United Kingdom
China
