Antibodies

View as table Download

DNase I (DNASE1) (1-252) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 252 of DNase I.

DNASE1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen Deoxyribonuclease I isolated and purified from Bovine pancreas.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit Polyclonal antibody to DNase I (deoxyribonuclease I)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 282 of DNase I (Uniprot ID#P24855)

Rabbit Polyclonal Anti-DNASE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNASE1 antibody: synthetic peptide directed towards the N terminal of human DNASE1. Synthetic peptide located within the following region: GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD

Rabbit Polyclonal Anti-DNASE1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DNASE1

DNASE1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DNASE1

DNASE1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-282 of human DNASE1 (NP_005214.2).
Modifications Unmodified