Antibodies

Jump to Filters
View as table Download
DNase I (DNASE1) (1-252) Rabbit Polyclonal Antibody
AP23615PU-N

USD 440.00

2 Weeks

DNase I (DNASE1) (1-252) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 252 of DNase I.
DNASE1 Rabbit Polyclonal Antibody
AP21248PU-N

USD 550.00

2 Weeks

DNASE1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen Deoxyribonuclease I isolated and purified from Bovine pancreas.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
DNase I (DNASE1) Rabbit Polyclonal Antibody
TA308546

USD 415.00

In Stock

Rabbit Polyclonal antibody to DNase I (deoxyribonuclease I)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 282 of DNase I (Uniprot ID#P24855)
DNase I (DNASE1) Rabbit Polyclonal Antibody
TA339005

USD 375.00

5 Days

Rabbit Polyclonal Anti-DNASE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNASE1 antibody: synthetic peptide directed towards the N terminal of human DNASE1. Synthetic peptide located within the following region: GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD
DNase I (DNASE1) Rabbit Polyclonal Antibody
TA349900

USD 345.00

In Stock

Rabbit Polyclonal Anti-DNASE1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DNASE1
DNASE1 Rabbit Polyclonal Antibody
TA364759

USD 380.00

4 Weeks

DNASE1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DNASE1
DNase I (DNASE1) Rabbit Polyclonal Antibody
TA375544

USD 275.00

3 Weeks

DNASE1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-282 of human DNASE1 (NP_005214.2).
Modifications Unmodified