Antibodies

Jump to Filters
View as table Download
DOK6 Rabbit Polyclonal Antibody
TA371781

USD 380.00

4 Weeks

DOK6 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human DOK6
DOK6 Rabbit Polyclonal Antibody
AP20534PU-N

USD 370.00

2 Weeks

DOK6 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
DOK6 Rabbit Polyclonal Antibody
TA347779

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-DOK6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DOK6 Antibody: A synthesized peptide derived from human DOK6
DOK6 Rabbit Polyclonal Antibody
TA316248

USD 345.00

4 Weeks

Rabbit polyclonal anti-DOK6 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DOK6.
DOK6 Rabbit Polyclonal Antibody
TA329777

USD 375.00

5 Days

Rabbit polyclonal Anti-DOK6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DOK6 antibody: synthetic peptide directed towards the middle region of human DOK6. Synthetic peptide located within the following region: IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLI
DOK6 Rabbit Polyclonal Antibody
TA367557

USD 380.00

4 Weeks

DOK6 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human DOK6