Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-DPF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DPF2 Antibody: synthetic peptide directed towards the middle region of human DPF2. Synthetic peptide located within the following region: GKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPD |
Rabbit Polyclonal Anti-DPF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DPF2 Antibody: synthetic peptide directed towards the middle region of human DPF2. Synthetic peptide located within the following region: RRGKGKSKGKGVGSARKKLDASILEDRDKPYACDICGKRYKNRPGLSYHY |
Rabbit Polyclonal Anti-DPF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DPF2 antibody: synthetic peptide directed towards the N terminal of human DPF2. Synthetic peptide located within the following region: MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQ |
Rabbit Polyclonal Anti-DPF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DPF2 antibody: synthetic peptide directed towards the middle region of human DPF2. Synthetic peptide located within the following region: QLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNS |
Rabbit Polyclonal Anti-DPF2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DPF2 |
DPF2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 126-391 of human DPF2 (NP_006259.1). |
| Modifications | Unmodified |
DPF2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DPF2. |
Active filters
Target Symbol
- DPF2