Rabbit Polyclonal Anti-DYNC2LI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DYNC2LI1 antibody is: synthetic peptide directed towards the N-terminal region of Human DYNC2LI1. Synthetic peptide located within the following region: LDRDEPPKPTLALEYTYGRRAKGHNTPKDIAHFWELGGGTSLLDLISIPI |
Rabbit Polyclonal Anti-DYNC2LI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DYNC2LI1 Antibody is: synthetic peptide directed towards the C-terminal region of Human DYNC2LI1. Synthetic peptide located within the following region: EKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKS |
DYNC2LI1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human DYNC2LI1 |
DYNC2LI1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-352 of human DYNC2LI1 (NP_001180393.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China