Rabbit Polyclonal Anti-EMG1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EMG1 antibody: synthetic peptide directed towards the N terminal of human EMG1. Synthetic peptide located within the following region: SLETVKVGKTYELLNCDKHKSILLKNGRDPGEARPDITHQSLLMLMDSPL |
Rabbit Polyclonal Anti-EMG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EMG1 antibody is: synthetic peptide directed towards the C-terminal region of Human EMG1. Synthetic peptide located within the following region: VSDVRELVPSSDPIVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAK |
EMG1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-244 of human EMG1 (NP_006322.4). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
